PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004695-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 289aa    MW: 31915.4 Da    PI: 10.308
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004695-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-1390134347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
  AHYPO_004695-RA  90 PWTEEEHKLFLLGLQTVGKGDWRGISRNFVKTRTPTQVASHAQKY 134
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.84383139IPR017930Myb domain
SuperFamilySSF466897.25E-1785140IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1686138IPR006447Myb domain, plants
SMARTSM007173.4E-1087137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1089134IPR009057Homeodomain-like
CDDcd001676.19E-990135No hitNo description
PfamPF002496.7E-1190134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MAKEDSMVVN GGGEFMLFGV RVVVDSMRKS VSLNNLSQYE HRLDSSSSTN DVVPSDAPVT  60
NAGYASADEA VVNRSSTTAS ASRERKRGVP WTEEEHKLFL LGLQTVGKGD WRGISRNFVK  120
TRTPTQVASH AQKYFIRKSN INRRSRRRSS LFDITTDSVA VNQTDDQRIR KETNGGSQSI  180
PLQQQQQQSP KSENSSVIFS VQPQESIRFS SPSPPIYSYN RQQVVDYKMK MIETAATSSN  240
SSSKSMADFD LNLSLSLISS PDRANSRHSA FQVTQRFSNV GDSIISVA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678650.13e-90PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0J8CEP23e-90A0A0J8CEP2_BETVU; Uncharacterized protein
STRINGGLYMA05G01640.14e-65(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.23e-51MYB_related family protein